Verified memberOpen to offersChat enabled

firstclasscarvaleting.co.uk

SEO stats

RQS 1,930UV 170DA 1PA 16TF 0CF 3Refs 5Backlinks 5

30-day visits 1,924 Peak 1,537 on 24/08

Last 30 days28 Jul - 26 Aug 2026

About firstclasscarvaleting.co.uk

21 characters

1-word domain

No hyphens or numbers.

Clear buyer intent

Firstclasscarvaleting marketplacefirstclasscarvaleting directoryautomotive lead generationspecialist content site.

Platform: Domain LanderCategory: Automotive

Listed: 28 days agoRegistered: Unavailable

Extension: .co.ukDomain length: 21 characters

Word count: 1-word domainHyphens and numbers: No hyphens or numbers.

View Whois: Click here to view firstclasscarvaleting.co.uk whoisPrimary keywords: Firstclasscarvaleting

0 DomainUI members like this domain.0 DomainUI members would pass on this domain.

Current Price No Buy Now price

firstclasscarvaleting.co.uk domain name

Domain only unless the seller agrees otherwise.

Ownership verified

Terms confirmed before payment

Guided transfer process

1
Agree the price
Buy now or make an offer. Agree terms with the seller.
2
Confirm secure payment
Complete payment using the agreed safe payment method.
3
Receive the domain
Once payment is confirmed, the domain transfer can be started.